Get the source code from Github


title Online CA Classes
description Best Teachers for Online CA Classes. You will find Online Classes for CA Foundation, CA Inter & CA Final Courses. Best Online Classes
url Open (new window) |
    [0] => online ca classes
Open (new window) |
authorName Media City
Open (new window) |
Open (new window) |
providerName Onlinecaclasses
providerUrl Open (new window) |
language en
View all collected data

OEmbed data

All data collected

Meta data

All data collected
    [csrf-token] => Array
            [0] => nRJXbONVkbmw0DLs2CefIAoPuEhnSl22ypt0LNrt

    [viewport] => Array
            [0] => width=device-width, initial-scale=1, shrink-to-fit=no

    [author] => Array
            [0] => Media City

    [mobileoptimized] => Array
            [0] => 320

    [title] => Array
            [0] => Online CA Classes

    [description] => Array
            [0] => Best Teachers for Online CA Classes. You will find Online Classes for CA Foundation, CA Inter & CA Final Courses. Best Online Classes 

    [og:title] => Array
            [0] => Online CA Classes 

    [og:url] => Array
            [0] =>

    [og:description] => Array
            [0] => Best Teachers for Online CA Classes. You will find Online Classes for CA Foundation, CA Inter & CA Final Courses. Best Online Classes

    [og:image] => Array
            [0] =>

    [image] => Array
            [0] =>

    [og:type] => Array
            [0] => website

    [twitter:card] => Array
            [0] => summary_large_image

    [twitter:image] => Array
            [0] =>

    [twitter:title] => Array
            [0] => Online CA Classes 

    [twitter:description] => Array
            [0] => Best Teachers for Online CA Classes. You will find Online Classes for CA Foundation, CA Inter & CA Final Courses. Best Online Classes

    [twitter:site] => Array
            [0] =>

    [robots] => Array
            [0] => all

    [keywords] => Array
            [0] => Online CA Classes,

    [mobile-web-app-capable] => Array
            [0] => yes

    [application-name] => Array
            [0] => Online



    [apple-mobile-web-app-capable] => Array
            [0] => yes

    [apple-mobile-web-app-status-bar-style] => Array
            [0] => black

    [apple-mobile-web-app-title] => Array
            [0] => Online



    [msapplication-tileimage] => Array
            [0] =>


Linked data

All data collected

HTML content

                          <!DOCTYPE html>
    Copyright (c) 2021.
**********************************************************************************************************  -->
Template Name: eClass - Learning Management System 
Version: 4.2.0
Author: Media City
<!--[if IE 8]> <html lang="en" class="ie8 no-js"> <![endif]-->
<!--[if IE 9]> <html lang="en" class="ie9 no-js"> <![endif]-->
<!--[if !IE]> -->

<html lang="en" >
<!-- <![endif]-->
<!-- head -->

<meta http-equiv="Content-Type" content="text/html; charset=utf-8">

<meta name="csrf-token" content="nRJXbONVkbmw0DLs2CefIAoPuEhnSl22ypt0LNrt">

<title>Online Courses | Online CA Classes</title>
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
<meta name="author" content="Media City" />
<meta name="MobileOptimized" content="320" />

<meta name="title" content="Online CA Classes">
<meta name="description" content="Best Teachers for Online CA Classes. You will find Online Classes for CA Foundation, CA Inter &amp; CA Final Courses. Best Online Classes ">
<meta property="og:title" content="Online CA Classes ">
<meta property="og:url" content="">
<meta property="og:description" content="Best Teachers for Online CA Classes. You will find Online Classes for CA Foundation, CA Inter &amp; CA Final Courses. Best Online Classes">
<meta property="og:image" content="">
<meta itemprop="image" content="">
<meta property="og:type" content="website">

<meta name="twitter:card" content="summary_large_image">
<meta name="twitter:image" content="">
<meta property="twitter:title" content="Online CA Classes ">
<meta property="twitter:description" content="Best Teachers for Online CA Classes. You will find Online Classes for CA Foundation, CA Inter &amp; CA Final Courses. Best Online Classes">
<meta name="twitter:site" content="" />

<link rel="canonical" href=""/>
<meta name="robots" content="all">
<meta name="keywords" content="Online CA Classes,">
<link rel="icon" type="image/icon" href=" (1).png"> <!-- favicon-icon -->
<!-- theme styles -->
<link href="" rel="stylesheet" type="text/css"/> <!-- bootstrap css -->
<link href="|Poppins:300,400,500,700" rel="stylesheet"> <!--  google fonts -->
<link href=",500,600,700" rel="stylesheet"><!-- google fonts -->
<link rel="stylesheet" href="" /> <!--  fontawesome css -->
<link rel="stylesheet" href="" /> <!-- fontawesome css -->
<link rel="stylesheet" href="" /> <!-- navigation css -->
<link rel="stylesheet" href="" /> <!-- owl carousel css -->
<link rel="stylesheet" href="" /> <!-- menu css -->

<link href="" rel="stylesheet" type="text/css"/> <!-- custom css -->
<link rel="stylesheet" href="">
<link rel="stylesheet" href=""><!-- fontawesome css -->
<link rel="stylesheet" href=""> <!-- select2 css -->
<link rel="stylesheet" href="">
<link rel="stylesheet" type="text/css" href="" /> <!-- protip css -->

<link rel="stylesheet" href=""/>

<link rel="stylesheet" href="" />
<link rel="stylesheet" href="" />
<link rel="stylesheet" href=""> 
  <!-- Web Application Manifest -->
<link rel="manifest" href="">
<!-- Chrome for Android theme color -->
<meta name="theme-color" content="">

<!-- Add to homescreen for Chrome on Android -->
<meta name="mobile-web-app-capable" content="yes">
<meta name="application-name" content="Online


<link rel="icon" sizes="512x512" href="">

<!-- Add to homescreen for Safari on iOS -->
<meta name="apple-mobile-web-app-capable" content="yes">
<meta name="apple-mobile-web-app-status-bar-style" content="black">
<meta name="apple-mobile-web-app-title" content="Online


<link rel="apple-touch-icon" href="">

<link href="" media="(device-width: 320px) and (device-height: 568px) and (-webkit-device-pixel-ratio: 2)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 375px) and (device-height: 667px) and (-webkit-device-pixel-ratio: 2)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 621px) and (device-height: 1104px) and (-webkit-device-pixel-ratio: 3)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 375px) and (device-height: 812px) and (-webkit-device-pixel-ratio: 3)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 414px) and (device-height: 896px) and (-webkit-device-pixel-ratio: 2)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 414px) and (device-height: 896px) and (-webkit-device-pixel-ratio: 3)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 768px) and (device-height: 1024px) and (-webkit-device-pixel-ratio: 2)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 834px) and (device-height: 1112px) and (-webkit-device-pixel-ratio: 2)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 834px) and (device-height: 1194px) and (-webkit-device-pixel-ratio: 2)" rel="apple-touch-startup-image" />
<link href="" media="(device-width: 1024px) and (device-height: 1366px) and (-webkit-device-pixel-ratio: 2)" rel="apple-touch-startup-image" />

<!-- Tile for Win8 -->
<meta name="msapplication-TileColor" content="">
<meta name="msapplication-TileImage" content="">

<script type="text/javascript">
    // Initialize the service worker
    if ('serviceWorker' in navigator) {
        navigator.serviceWorker.register('', {
            scope: '.'
        }).then(function (registration) {
            // Registration was successful
            console.log('Laravel PWA: ServiceWorker registration successful with scope: ', registration.scope);
        }, function (err) {
            // registration failed :(
            console.log('Laravel PWA: ServiceWorker registration failed: ', err);

<!-- end theme styles -->

<style type="text/css">
  :root {
  --linear-gradient-bg-color:linear-gradient(-45deg, #f44a4a 0, #6e1a52 100%);
  --linear-gradient-reverse-bg-color:linear-gradient(-45deg, #6e1a52 0, #f44a4a 100%);
  --linear-gradient-about-bg-color:linear-gradient(197.61deg, #f44a4a , #6e1a52);
  --linear-gradient-about-blue-bg-color:linear-gradient(40deg, #1a263a 33%, #4a8394 84%);
  --linear-gradient-career-bg-color:linear-gradient(22.72914987deg, #f5c252 4%, #6ac1d0);
  --background-blue-bg-color: #0284a2;
  --background-red-bg-color: #f44a4a; 

<style type="text/css">
  :root {
  --linear-gradient-bg-color:linear-gradient(-45deg, #f44a4a 0, #6e1a52 100%);
  --linear-gradient-reverse-bg-color:linear-gradient(-45deg, #6e1a52 0, #f44a4a 100%);
  --linear-gradient-about-bg-color:linear-gradient(197.61deg, #f44a4a , #6e1a52);
  --linear-gradient-about-blue-bg-color:linear-gradient(40deg, #1a263a 33%, #4a8394 84%);
  --linear-gradient-career-bg-color:linear-gradient(22.72914987deg, #f5c252 4%, #6ac1d0);
  --background-blue-bg-color: #0284a2;
  --background-red-bg-color: #f44a4a; 

    #cookieWrapper {
        position: fixed;
        bottom: 0;
        width: 100%;
        z-index: 100;
        margin: 0;
        border-radius: 0;
        background-color: var(--background-blue-bg-color) !important;

    .bg-primary {
	    background-color: var(--background-blue-bg-color) !important;
	.btn-warning {
	    background-color: var(--background-red-bg-color)!important;
	    border: 1px solid var(--background-red-bg-color)!important;
	    color: var(--text-white-color);
    .cookie-consent__message {
        color: var(--text-white-color);

<div id="cookieWrapper" class="bg-primary text-white w-100 py-3 text-center cookierbar js-cookie-consent cookie-consent">
    <span class="cookie-consent__message">
        Your experience on this site will be improved by allowing cookies.&nbsp;&nbsp;
    <button class="btn btn-sm btn-warning js-cookie-consent-agree cookie-consent__agree">
        Allow cookies


        window.laravelCookieConsent = (function () {

            const COOKIE_VALUE = 1;
            const COOKIE_DOMAIN = '';

            function consentWithCookies() {
                setCookie('laravel_cookie_consent', COOKIE_VALUE, 7300);

            function cookieExists(name) {
                return (document.cookie.split('; ').indexOf(name + '=' + COOKIE_VALUE) !== -1);

            function hideCookieDialog() {
                const dialogs = document.getElementsByClassName('js-cookie-consent');

                for (let i = 0; i < dialogs.length; ++i) {
                    dialogs[i].style.display = 'none';

            function setCookie(name, value, expirationInDays) {
                const date = new Date();
                date.setTime(date.getTime() + (expirationInDays * 24 * 60 * 60 * 1000));
                document.cookie = name + '=' + value
                    + ';expires=' + date.toUTCString()
                    + ';domain=' + COOKIE_DOMAIN
                    + ';path=/'
                    + '';

            if (cookieExists('laravel_cookie_consent')) {

            const buttons = document.getElementsByClassName('js-cookie-consent-agree');

            for (let i = 0; i < buttons.length; ++i) {
                buttons[i].addEventListener('click', consentWithCookies);

            return {
                consentWithCookies: consentWithCookies,
                hideCookieDialog: hideCookieDialog

<!-- end head -->
<!-- body start-->
<!-- preloader --> 

<div class="preloader">
    <div class="status">

<!-- whatsapp chat button -->
<div id="myButton"></div>

<!-- end preloader -->
<!-- top-nav bar start-->
<section id="nav-bar" class="nav-bar-main-block">
    <div class="container">
        <!-- start navigation -->
        <div class="navigation fullscreen-search-block">
            <span style="font-size:30px;cursor:pointer" onclick="openNav()" class="hamburger">&#9776; </span>
            <div class="logo">

                                    <a href="" ><img src="" class="img-fluid" alt="logo"></a>
            <div class="nav-search nav-wishlist">
                <a href="#find"><i data-feather="search"></i></a>

            <div id="mySidenav" class="sidenav">
              <a href="javascript:void(0)" class="closebtn" onclick="closeNav()">&times;</a>
                                <div class="login-block">
                    <a href="" class="btn btn-primary" title="register">Signup</a>
                    <a href="" class="btn btn-secondary" title="login">Login</a>
                <div class="wrapper center-block">
                    <div class="panel-group" id="accordion" role="tablist" aria-multiselectable="true">
                                          <div class="panel panel-default">
                        <div class="panel-heading active" role="tab" id="headingOne">
                            <h4 class="panel-title">
                            <a role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseOne9" aria-expanded="true" aria-controls="collapseOne">
                                <i class="fa fa-window-maximize rgt-10"></i> <label class="prime-cat" data-url=";category=bestcoachingcafinalonlineclassespendrive">CA-Final</label> 

                        <div id="collapseOne9" class="subcate-collapse panel-collapse collapse in" role="tabpanel" aria-labelledby="headingOne">
                                                                            <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven31" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalfrfinancialreportingbestonlineclassespendrive">Financial Repor..</label>


                                <div id="collapseeleven31" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven32" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalsfmstrategicfinancialmanagementbestonlineclassespendrive">Strategic Finan..</label>


                                <div id="collapseeleven32" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven33" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinaladvancedauditingandprofessionalethicsbestonlineclassespendrive">Advanced Auditi..</label>


                                <div id="collapseeleven33" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven34" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalcorporateandeconomiclawsbestonlineclassespendrive">Corporate and E..</label>


                                <div id="collapseeleven34" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven35" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalcostingstrategiccostmanagementperformanceevaluationbestonlineclassespendrive">Strategic Cost..</label>


                                <div id="collapseeleven35" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven36" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalriskmanagementbestonlineclassespendrive">Risk Management</label>


                                <div id="collapseeleven36" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven37" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalfinancialservicesandcapitalmarketsbestonlineclassespendrive">Financial Servi..</label>


                                <div id="collapseeleven37" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven38" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalinternationaltaxationtaxbestonlineclassespendrive">International T..</label>


                                <div id="collapseeleven38" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven39" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinaleconomicslawsbestonlineclassespendrive">Economics Laws</label>


                                <div id="collapseeleven39" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven40" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinaldirecttaxlawsandinternationaltaxationbestonlineclassespendrive">Direct Tax Laws..</label>


                                <div id="collapseeleven40" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven41" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalindirecttaxlawsbestonlineclassespendrive">Indirect Tax La..</label>


                                <div id="collapseeleven41" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven42" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalglobalfinancialrepostingstandardsbestonlineclassespendrive">Global Financia..</label>


                                <div id="collapseeleven42" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven43" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cafinalmultidisciplinarycasestudybestonlineclassespendrive">Multidisciplina..</label>


                                <div id="collapseeleven43" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                          <div class="panel panel-default">
                        <div class="panel-heading active" role="tab" id="headingOne">
                            <h4 class="panel-title">
                            <a role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseOne10" aria-expanded="true" aria-controls="collapseOne">
                                <i class="fa fa-tv rgt-10"></i> <label class="prime-cat" data-url=";category=stockmarketcourses">Stock Market</label> 

                        <div id="collapseOne10" class="subcate-collapse panel-collapse collapse in" role="tabpanel" aria-labelledby="headingOne">
                                                                            <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven21" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-desktop rgt-10"></i> <label class="sub-cate" data-url=";category=crashcoursestockmarket">Crash Course -..</label>


                                <div id="collapseeleven21" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                          <div class="panel panel-default">
                        <div class="panel-heading active" role="tab" id="headingOne">
                            <h4 class="panel-title">
                            <a role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseOne11" aria-expanded="true" aria-controls="collapseOne">
                                <i class="fa fa-window-maximize rgt-10"></i> <label class="prime-cat" data-url=";category=camockexamtestseries">Mock Test Series</label> 

                        <div id="collapseOne11" class="subcate-collapse panel-collapse collapse in" role="tabpanel" aria-labelledby="headingOne">
                                                                            <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven23" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-genderless rgt-10"></i> <label class="sub-cate" data-url=";category=cafoundationtestseries">CA Foundation T..</label>


                                <div id="collapseeleven23" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                          <div class="panel panel-default">
                        <div class="panel-heading active" role="tab" id="headingOne">
                            <h4 class="panel-title">
                            <a role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseOne7" aria-expanded="true" aria-controls="collapseOne">
                                <i class="fa fa-window-maximize rgt-10"></i> <label class="prime-cat" data-url=";category=bestcoachingcafoundationonlineclassespendrive">CA Foundation</label> 

                        <div id="collapseOne7" class="subcate-collapse panel-collapse collapse in" role="tabpanel" aria-labelledby="headingOne">
                                                                            <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven17" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-balance-scale rgt-10"></i> <label class="sub-cate" data-url=";category=bestcoachinglawenglishcafoundationonlineclasses">Law &amp; English</label>


                                <div id="collapseeleven17" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body sub-cat">
                                    <i class="fa Choose icon rgt-10"></i> <label class="child-cate" data-url=";category=cafoundationlawenglishenglishmediumpendrivelivegoogleclasses">English Medium </label>
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven18" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-edge rgt-10"></i> <label class="sub-cate" data-url=";category=bestcoachingcafoundationmathsonlineclasses">Maths</label>


                                <div id="collapseeleven18" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven19" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-money rgt-10"></i> <label class="sub-cate" data-url=";category=bestcoachingcafoundationaccountsonlineclasses">Accounts</label>


                                <div id="collapseeleven19" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven20" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-genderless rgt-10"></i> <label class="sub-cate" data-url=";category=bestcoachingcafoundationeconomicsonlineclasses">Economics</label>


                                <div id="collapseeleven20" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven22" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-desktop rgt-10"></i> <label class="sub-cate" data-url=";category=bestcoachingallsubjectscafoundationonlineclasses">All Subjects</label>


                                <div id="collapseeleven22" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                          <div class="panel panel-default">
                        <div class="panel-heading active" role="tab" id="headingOne">
                            <h4 class="panel-title">
                            <a role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseOne8" aria-expanded="true" aria-controls="collapseOne">
                                <i class="fa fa-window-maximize rgt-10"></i> <label class="prime-cat" data-url=";category=bestcoachingcainteronlineclassespendrive">CA-Inter</label> 

                        <div id="collapseOne8" class="subcate-collapse panel-collapse collapse in" role="tabpanel" aria-labelledby="headingOne">
                                                                            <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven16" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-money rgt-10"></i> <label class="sub-cate" data-url=";category=bestcoachingcainteraccountsonlineclasses">Accounts</label>


                                <div id="collapseeleven16" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven24" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-balance-scale rgt-10"></i> <label class="sub-cate" data-url=";category=caintermediateintercorporateandotherlawsonlineclassespendrive">Corporate and O..</label>


                                <div id="collapseeleven24" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven25" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-money rgt-10"></i> <label class="sub-cate" data-url=";category=caintercostingcostingandmanagementaccountingonlineclassespendrive">Costing</label>


                                <div id="collapseeleven25" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven26" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa fa-money rgt-10"></i> <label class="sub-cate" data-url=";category=caintertaxationonlineclassespendrive">Taxation</label>


                                <div id="collapseeleven26" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven27" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cainterintermediateadvancedaccountingonlineclassespendrive">Advanced Accoun..</label>


                                <div id="collapseeleven27" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven28" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=cainterintermediateauditingandassurancebestonlineclassespendrive">Auditing and As..</label>


                                <div id="collapseeleven28" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven29" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=caintermediateinterenterpriseinformationsystemsstrategicmanagementbestonlineclassespendrive">Enterprise Info..</label>


                                <div id="collapseeleven29" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
                                                                                                      <div class="panel-body">
                            <div class="panel panel-default">
                                <div class="panel-heading" role="tab" id="headingeleven">
                                  <h4 class="panel-title">
                                    <a class="collapsed" role="button" data-toggle="collapse" data-parent="#accordion" href="#collapseeleven30" aria-expanded="false" aria-controls="collapseeleven">
                                      <i class="fa Choose icon rgt-10"></i> <label class="sub-cate" data-url=";category=caintermediateinterfinancialmanagementeconomicsforfinancebestonlineclassespendrive">Financial Manag..</label>


                                <div id="collapseeleven30" class="panel-collapse collapse" role="tabpanel" aria-labelledby="headingeleven">
        <!-- end navigation -->
        <div class="row smallscreen-search-block">
            <div class="col-lg-5">
                <div class="row">
                    <div class="col-lg-6 col-md-4 col-sm-12">
                        <div class="logo">

                                                            <a href="" ><img src="" class="img-fluid" alt="logo"></a>
                    <div class="col-lg-6 col-md-4 col-sm-12">
                        <div class="navigation">
                            <div id="cssmenu">
                                    <li><a href="#" title="Categories"><i class="flaticon-grid"></i>Categories</a>
                                                                                                                                    <li><a href=";category=CA-Final" title="CA-Final"><i class="fa fa-window-maximize rgt-20"></i>CA-Final<i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                <li><a href=";category=Financial%20Reporting" title="Financial Reporting"><i class="fa Choose icon rgt-20"></i>Financial Reporting
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Strategic%20Financial%20Management" title="Strategic Financial Management"><i class="fa Choose icon rgt-20"></i>Strategic Financial Manag..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Advanced%20Auditing%20and%20Professional%20Ethics" title="Advanced Auditing and Professional Ethics"><i class="fa Choose icon rgt-20"></i>Advanced Auditing and Pro..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Corporate%20and%20Economic%20Laws" title="Corporate and Economic Laws"><i class="fa Choose icon rgt-20"></i>Corporate and Economic La..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Strategic%20Cost%20Management%20and%20Performance%20Evaluation" title="Strategic Cost Management and Performance Evaluation"><i class="fa Choose icon rgt-20"></i>Strategic Cost Management..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Risk%20Management" title="Risk Management"><i class="fa Choose icon rgt-20"></i>Risk Management
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Financial%20Services%20and%20Capital%20Markets" title="Financial Services and Capital Markets"><i class="fa Choose icon rgt-20"></i>Financial Services and Ca..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=International%20Taxation" title="International Taxation"><i class="fa Choose icon rgt-20"></i>International Taxation
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Economics%20Laws" title="Economics Laws"><i class="fa Choose icon rgt-20"></i>Economics Laws
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Direct%20Tax%20Laws%20and%20International%20Taxation" title="Direct Tax Laws and International Taxation"><i class="fa Choose icon rgt-20"></i>Direct Tax Laws and Inter..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Indirect%20Tax%20Laws" title="Indirect Tax Laws"><i class="fa Choose icon rgt-20"></i>Indirect Tax Laws
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Global%20Financial%20Reposting%20Standards" title="Global Financial Reposting Standards"><i class="fa Choose icon rgt-20"></i>Global Financial Repostin..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Multidisciplinary%20Case%20Study" title="Multidisciplinary Case Study"><i class="fa Choose icon rgt-20"></i>Multidisciplinary Case St..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                <li><a href=";category=Stock%20Market" title="Stock Market"><i class="fa fa-tv rgt-20"></i>Stock Market<i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                <li><a href=";category=Crash%20Course%20-%20Stock%20Market" title="Crash Course - Stock Market"><i class="fa fa-desktop rgt-20"></i>Crash Course - Stock Mark..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                <li><a href=";category=Mock%20Test%20Series" title="Mock Test Series"><i class="fa fa-window-maximize rgt-20"></i>Mock Test Series<i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                <li><a href=";category=CA%20Foundation%20Test%20Series" title="CA Foundation Test Series"><i class="fa fa-genderless rgt-20"></i>CA Foundation Test Series
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                <li><a href=";category=CA%20Foundation" title="CA Foundation"><i class="fa fa-window-maximize rgt-20"></i>CA Foundation<i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                <li><a href=";category=Law%20%26%20English" title="Law &amp; English"><i class="fa fa-balance-scale rgt-20"></i>Law &amp; English
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                            <a href=";category=English%20Medium" title="English Medium"><i class="fa Choose icon rgt-20"></i>English Medium</a>
                                                                                                                                                                                               <li><a href=";category=Maths" title="Maths"><i class="fa fa-edge rgt-20"></i>Maths
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Accounts" title="Accounts"><i class="fa fa-money rgt-20"></i>Accounts
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Economics" title="Economics"><i class="fa fa-genderless rgt-20"></i>Economics
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=All%20Subjects" title="All Subjects"><i class="fa fa-desktop rgt-20"></i>All Subjects
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                <li><a href=";category=CA-Inter" title="CA-Inter"><i class="fa fa-window-maximize rgt-20"></i>CA-Inter<i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                <li><a href=";category=Accounts" title="Accounts"><i class="fa fa-money rgt-20"></i>Accounts
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Corporate%20and%20Other%20Laws" title="Corporate and Other Laws"><i class="fa fa-balance-scale rgt-20"></i>Corporate and Other Laws
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Costing" title="Costing"><i class="fa fa-money rgt-20"></i>Costing
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Taxation" title="Taxation"><i class="fa fa-money rgt-20"></i>Taxation
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Advanced%20Accounting" title="Advanced Accounting"><i class="fa Choose icon rgt-20"></i>Advanced Accounting
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Auditing%20and%20Assurance" title="Auditing and Assurance"><i class="fa Choose icon rgt-20"></i>Auditing and Assurance
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Enterprise%20Information%20Systems%20%26%20Strategic%20Management" title="Enterprise Information Systems &amp; Strategic Management"><i class="fa Choose icon rgt-20"></i>Enterprise Information Sy..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
                                                                                                                                                                                               <li><a href=";category=Financial%20Management%20%26%20Economics%20for%20Finance" title="Financial Management &amp; Economics for Finance"><i class="fa Choose icon rgt-20"></i>Financial Management &amp; Ec..
                                                    <i class="fa fa-chevron-right float-rgt"></i></a>
            <div class="col-lg-7">
                                <div class="row">
                    <div class="col-lg-6 col-md-6">
                        <div class="learning-business">
                    <div class="col-lg-1">
                        <div class="shopping-cart">
                            <a href="" title="Cart"><i data-feather="shopping-cart"></i></a>
                            <span class="red-menu-badge red-bg-success">
                                0                            </span>
                    <div class="col-lg-1">
                        <div class="search search-one" id="search">
                            <form method="GET" id="searchform" action="">
                              <div class="search-input-wrap">
                                <input class="search-input" name="searchTerm" placeholder="Search in Site" type="text" id="course_name" autocomplete="off" />
                              <input class="search-submit" type="submit" id="go" value="">
                              <div class="icon"><i data-feather="search"></i></div>
                              <div id="course_data"></div>
                    <div class="col-lg-4">
                        <div class="Login-btn">
                            <a href="" class="btn btn-secondary" title="login">Login</a>
                            <a href="" class="btn btn-primary" title="register">Signup</a>

<!-- start search -->
<div id="find" class="small-screen-navigation">
    <button type="button" class="close">×</button>
     <form action="" class="form-inline search-form" method="GET">
         <input type="find" name="searchTerm" class="form-control" id="search"  placeholder="Search for courses" value="">
         <button type="submit" class="btn btn-outline-info btn_sm">Search</button> 
<!-- start end -->

<!-- side navigation  -->
function openNav() {
  document.getElementById("mySidenav").style.width = "250px";

function closeNav() {
  document.getElementById("mySidenav").style.width = "0";

<div class="modal fade" data-backdrop="" style="z-index: 99999999999999999;" id="myModalinstructor" tabindex="-1" role="dialog" aria-labelledby="myModalLabel">
    <div class="modal-dialog modal-lg" role="document">
      <div class="modal-content">
        <div class="modal-header">

          <h4 class="modal-title" id="myModalLabel">Become An Instructor</h4>
          <button type="button" class="close" data-dismiss="modal" aria-label="Close"><span aria-hidden="true">&times;</span></button>
        <div class="box box-primary">
          <div class="panel panel-sum">
            <div class="modal-body">
                              <div class="box-footer">
                  <button type="submit" onclick="window.location.href = '';" class="btn btn-lg col-md-3 btn-primary">Submit</button>
<!-- top-nav bar end-->
<!-- home start -->

<!-- categories-tab start-->

<section id="categories-tab" class="categories-tab-main-block">
    <div class="container">
        <div id="categories-tab-slider" class="categories-tab-block owl-carousel">
                                            <div class="item categories-tab-dtl">
                    <a href=";category=bestcoachingcafinalonlineclassespendrive" title="CA-Final"><i class="fa fa-window-maximize"></i>CA-Final</a>
                                                            <div class="item categories-tab-dtl">
                    <a href=";category=stockmarketcourses" title="Stock Market"><i class="fa fa-tv"></i>Stock Market</a>
                                                            <div class="item categories-tab-dtl">
                    <a href=";category=camockexamtestseries" title="Mock Test Series"><i class="fa fa-window-maximize"></i>Mock Test Series</a>
                                                            <div class="item categories-tab-dtl">
                    <a href=";category=bestcoachingcafoundationonlineclassespendrive" title="CA Foundation"><i class="fa fa-window-maximize"></i>CA Foundation</a>
                                                            <div class="item categories-tab-dtl">
                    <a href=";category=bestcoachingcainteronlineclassespendrive" title="CA-Inter"><i class="fa fa-window-maximize"></i>CA-Inter</a>
<!-- categories-tab end-->

<section id="home-background-slider" class="background-slider-block owl-carousel">
    <div class="lazy item home-slider-img">
                <div id="home" class="home-main-block" style="background-image: url('')">
            <div class="container">
                <div class="row">
                    <div class="col-lg-12 ">
                        <div class="home-dtl">
                            <div class="home-heading">Online CA</div>
                            <p class="btm-10">CA FOUNDATION | CA INTERMEDIATE</p>
                            <p class="btm-20">CA FINAL | MOCK TEST SERIES</div>

                                                            <div class="home-search">
                                    <form method="GET" id="searchform" action="">
                                        <div class="search">
                                          <input type="text" name="searchTerm" class="searchTerm" placeholder="What do you want to learn?">
                                          <button type="submit" class="searchButton">
                                            <i class="fa fa-search"></i>

                <div id="home" class="home-main-block" style="background-image: url('')">
            <div class="container">
                <div class="row">
                    <div class="col-lg-12 col-md-offset-6 col-sm-offset-6 col-sm-6 col-md-6 text-right">
                        <div class="home-dtl">
                            <div class="home-heading">Free Premium Portfolio website from</div>
                            <p class="btm-10">worth Rs.3499</p>
                            <p class="btm-20">with Every Purchase</div>

                <div id="home" class="home-main-block" style="background-image: url('')">
            <div class="container">
                <div class="row">
                    <div class="col-lg-12 ">
                        <div class="home-dtl">
                            <div class="home-heading">Free Premium Digital CV from</div>
                            <p class="btm-10">worth Rs.3499</p>
                            <p class="btm-20">with Every Purchase</div>

                <div id="home" class="home-main-block" style="background-image: url('')">
            <div class="container">
                <div class="row">
                    <div class="col-lg-12 ">
                        <div class="home-dtl">
                            <div class="home-heading">Best Android &amp; Ios Experience on mobile</div>
                            <p class="btm-10">Download our App</p>
                            <p class="btm-20"></div>

                <div id="home" class="home-main-block" style="background-image: url('')">
            <div class="container">
                <div class="row">
                    <div class="col-lg-12 ">
                        <div class="home-dtl">
                            <div class="home-heading">Start your Google Drive Classes</div>
                            <p class="btm-10">For CA Foundation classes from CA Vaibhav Jalan</p>
                            <p class="btm-20">10 Views &amp;  and 300 Days Validity of Lectures</div>

                <div id="home" class="home-main-block" style="background-image: url('')">
            <div class="container">
                <div class="row">
                    <div class="col-lg-12 ">
                        <div class="home-dtl">
                            <div class="home-heading">Full Syllabus Mock Tests Subscription</div>
                            <p class="btm-10">For CA Foundation by CA Vaibhav Jalan</p>
                            <p class="btm-20">For Rs.1199 only</div>

<!-- home end -->
<!-- learning-work start -->
<section id="learning-work" class="learning-work-main-block">
    <div class="container">
        <div class="row">
                        <div class="col-lg-4 col-sm-6">
                <div class="learning-work-block">
                    <div class="row">
                        <div class="col-lg-3 col-md-3">
                            <div class="learning-work-icon">
                                <i class="fa fa-anchor"></i>
                        <div class="col-lg-9 col-md-9">
                            <div class="learning-work-dtl">
                                <div class="work-heading">Learn Anytime, Anywhere</div>
                                <p>Online Courses for Your Convenience</p>
                        <div class="col-lg-4 col-sm-6">
                <div class="learning-work-block">
                    <div class="row">
                        <div class="col-lg-3 col-md-3">
                            <div class="learning-work-icon">
                                <i class="fa fa-magic"></i>
                        <div class="col-lg-9 col-md-9">
                            <div class="learning-work-dtl">
                                <div class="work-heading">Learn at Your Speed</div>
                                <p>Headstart for Your Career</p>
                        <div class="col-lg-4 col-sm-6">
                <div class="learning-work-block">
                    <div class="row">
                        <div class="col-lg-3 col-md-3">
                            <div class="learning-work-icon">
                                <i class="fa fa-graduation-cap"></i>
                        <div class="col-lg-9 col-md-9">
                            <div class="learning-work-dtl">
                                <div class="work-heading">Doubts Session &amp; individual Attention</div>
                                <p>Learn on your schedule</p>
<!-- learning-work end -->

<!-- Advertisement -->

<!-- Student start -->

<!-- Students end -->

<!-- Student start -->
<!-- Students end -->

<!-- learning-courses start -->
<section id="learning-courses" class="learning-courses-main-block">
    <div class="container">
        <div class="row">
            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                <h4 class="student-heading">Recently Added Courses</h4>
            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                <div class="btn_more float-right">

        <div class="row">

            <div class="col-lg-12">
                <div class="learning-courses">
                                        <ul class="nav nav-tabs" id="myTab" role="tablist">
                            <li class="btn nav-item" ><a class="nav-item nav-link" id="home-tab" data-toggle="tab" href="#content-tabs" role="tab" aria-controls="home" onclick="showtab('7')" aria-selected="true">CA Foundation</a></li>
                            <li class="btn nav-item" ><a class="nav-item nav-link" id="home-tab" data-toggle="tab" href="#content-tabs" role="tab" aria-controls="home" onclick="showtab('8')" aria-selected="true">CA-Inter</a></li>
                            <li class="btn nav-item" ><a class="nav-item nav-link" id="home-tab" data-toggle="tab" href="#content-tabs" role="tab" aria-controls="home" onclick="showtab('10')" aria-selected="true">Stock Market</a></li>
                            <li class="btn nav-item" ><a class="nav-item nav-link" id="home-tab" data-toggle="tab" href="#content-tabs" role="tab" aria-controls="home" onclick="showtab('9')" aria-selected="true">CA-Final</a></li>
                <div class="tab-content" id="myTabContent">
                                                    <div class="tab-pane fade show active" id="content-tabs" role="tabpanel" aria-labelledby="home-tab">
                                <div id="tabShow">
                                                    <div class="tab-pane fade show active" id="content-tabs" role="tabpanel" aria-labelledby="home-tab">
                                <div id="tabShow">
                                                    <div class="tab-pane fade show active" id="content-tabs" role="tabpanel" aria-labelledby="home-tab">
                                <div id="tabShow">
                                                    <div class="tab-pane fade show active" id="content-tabs" role="tabpanel" aria-labelledby="home-tab">
                                <div id="tabShow">
<!-- learning-courses end -->

<!-- Advertisement -->

<!-- Advertisement -->
<!-- Student start -->

<section id="student" class="student-main-block">
    <div class="container">
        <h4 class="student-heading">Featured Courses</h4>
        <div id="student-view-slider" class="student-view-slider-main-block owl-carousel">
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block25">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src=" (2).png" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Law &amp; English- CA Foundation</a></div>
                                <div class="user-name">
                                    <h6>By <span>CA Vaibhav Jalan</span></h6>
                                <div class="rating">
                                            <div class="pull-left">
                                                <div class="star-ratings-sprite"><span style="width:100%" class="star-ratings-sprite-rating"></span>
                                        <!-- overall rating-->
                                                                                                                        <!-- <li>
                                        </li> -->
                                                                                <li class="reviews">
                                            (1 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" &amp; English- CA Foundation" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block25" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 10th January 2022</p>

                                <h5 class="description-heading">Law &amp; English- CA Foundation</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            4                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     121 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Law &amp; English- CA Foundation by CA Vaibhav Jalan</p>
                                                                                                                                                                <div class="product-learn-dtl">
                                                    <li><i data-feather="check-circle"></i>Student will learn everything required to clear the law exam of CA Foundation</li>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block26">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src=" (2).png" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Costing-CA Intermediate</a></div>
                                <div class="user-name">
                                    <h6>By <span>CA Vaibhav Jalan</span></h6>
                                <div class="rating">
                                            <div class="pull-left">
                                                <div class="star-ratings-sprite"><span style="width:100%" class="star-ratings-sprite-rating"></span>
                                        <!-- overall rating-->
                                                                                                                        <!-- <li>
                                        </li> -->
                                                                                <li class="reviews">
                                            (1 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block26" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Costing-CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Costing-CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block32">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src=" (2).png" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">All Subjects - CA Foundation</a></div>
                                <div class="user-name">
                                    <h6>By <span>CA Vaibhav Jalan</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Subjects - CA Foundation" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block32" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 11th December 2021</p>

                                <h5 class="description-heading">All Subjects - CA Foundation</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>This Course enables you to enroll for the CA Foundation classes by CA Vaibhav Jalan. Check out the Description for more Details

This Course comes with CA Test app where students can test their knowledge and prepare for the exams. Result of CA Vaibhav Jalan Speaks for itself</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block34">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">onsale</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Stock Market Basics</a></div>
                                <div class="user-name">
                                    <h6>By <span>CA Divya</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Market Basics" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block34" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 3rd January 2022</p>

                                <h5 class="description-heading">Stock Market Basics</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>One of the good Course for Stock Market</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block35">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src=" (2).png" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Economics-  CA Foundation Busi...</a></div>
                                <div class="user-name">
                                    <h6>By <span>CA Vaibhav Jalan</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href="  CA Foundation Business Economics and Business and Commercial Knowledge" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block35" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 11th December 2021</p>

                                <h5 class="description-heading">Economics-  CA Foundation Business Economics and Business and Commercial Knowledge</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            4                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     121 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Economics-  CA Foundation Business Economics and Business and Commercial Knowledge</p>
                                                                                                                                                                <div class="product-learn-dtl">
                                                    <li><i data-feather="check-circle"></i>Student will learn everything required to clear the law exam of CA Foundation</li>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block36">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src=" (2).png" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Mathematics -CA Foundation - B...</a></div>
                                <div class="user-name">
                                    <h6>By <span>CA Vaibhav Jalan</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" -CA Foundation - Business Maths,Logical Reasoning and Statistics" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block36" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 14th December 2021</p>

                                <h5 class="description-heading">Mathematics -CA Foundation - Business Maths,Logical Reasoning and Statistics</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            4                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     121 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Mathematics -CA Foundation - Business Maths, Logical Reasoning and Statistics</p>
                                                                                                                                                                <div class="product-learn-dtl">
                                                    <li><i data-feather="check-circle"></i>Student will learn everything required to clear the law exam of CA Foundation</li>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block37">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" (1).png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src=" (2).png" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Accounts - CA Foundation - Pri...</a></div>
                                <div class="user-name">
                                    <h6>By <span>CA Vaibhav Jalan</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" - CA Foundation - Principles and Practice of Accounting" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block37" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 11th December 2021</p>

                                <h5 class="description-heading">Accounts - CA Foundation - Principles and Practice of Accounting</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Accounts - CA Foundation - Principles and Practice of Accounting by CA Vaibhav Jalan</p>
                                                                                                                                                                <div class="product-learn-dtl">
                                                    <li><i data-feather="check-circle"></i>Student will learn everything required to clear the Accounts Exam Paper of CA Foundation</li>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block38">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">onsale</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Taxation-CA Intermediate</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block38" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Taxation-CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Taxation-CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block39">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">onsale</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Accounts-CA Intermediate</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">



                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block39" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 17th December 2021</p>

                                <h5 class="description-heading">Accounts-CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Accounts-CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                    <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block40">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=";-Other-Laws-In-1.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">onsale</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Corporate &amp; Other Laws- CA Int...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" &amp; Other Laws- CA Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block40" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 4th January 2022</p>

                                <h5 class="description-heading">Corporate &amp; Other Laws- CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Corporate &amp; Other Laws- CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block41">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Advanced Accounting- CA Interm...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Accounting- CA Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block41" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Advanced Accounting- CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Advanced Accounting- CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block42">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Auditing and Assurance- CA Int...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" and Assurance- CA Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block42" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Auditing and Assurance- CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Auditing and Assurance- CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block43">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">EISM- Enterprise Information S...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Enterprise Information Systems &amp; Strategic Management- CA Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block43" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">EISM- Enterprise Information Systems &amp; Strategic Management- CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>EISM- Enterprise Information Systems &amp; Strategic Management- CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block44">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=";-Economics-for-Finance-In-1.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Financial Management &amp; Economi...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Management &amp; Economics for Finance- CA Intermediate" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block44" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Financial Management &amp; Economics for Finance- CA Intermediate</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Financial Management &amp; Economics for Finance- CA Intermediate</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block45">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" Financial-Reporting.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">bestseller</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Financial Reporting- CA Final</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Reporting- CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block45" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Financial Reporting- CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Financial Reporting- CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block46">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" Strategic.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">onsale</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Strategic Financial Management...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Financial Management - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block46" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Strategic Financial Management - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Strategic Financial Management - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block47">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" Advanced.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">onsale</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Advanced Auditing and Professi...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Auditing and Professional Ethics - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block47" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Advanced Auditing and Professional Ethics - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Advanced Auditing and Professional Ethics - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block48">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" Corporate-and.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Corporate and Economic Laws -...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" and Economic Laws - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block48" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Corporate and Economic Laws - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Corporate and Economic Laws - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block49">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" Strategic-Cost.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Strategic Cost Management and...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Cost Management and Performance Evaluation - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block49" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Strategic Cost Management and Performance Evaluation - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Strategic Cost Management and Performance Evaluation- CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block50">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" Direct-Tax-Laws.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Direct Tax Laws and Internatio...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Tax Laws and International Taxation - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block50" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Direct Tax Laws and International Taxation - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Direct Tax Laws and International Taxation - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block51">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src=" Indirect.png" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Indirect Tax Laws - CA Final</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Tax Laws - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block51" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Indirect Tax Laws - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Indirect Tax Laws - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block52">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAADn0lEQVR4nO2cS0hUURjH//fO3DtavsqgLKEcSZEy7GVRuMjAihYSBYWLbFXUqoKCSOwBRZAUtIiWFUGQtKiNZVKp4cJaOT2MyMkyAu3ho1Hn3jv3tpAJH3PVkXK+c/h+cBfDvYvvzG++75zvnMsoOdcHHDBkUBMdADMWFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMb6IDGM+NbUko808dlmU7GDSBkOmgP+wg2Ofgw08bgZ4Imr5EYERmIdj/ADkh08WrKkjzAWk+BVkpQH4msN0/ci9kOmgIWrj2ykCwT6wTailL1lxNQXmehrq9c3Big57ocOJCSiFRdI+Cw2t0XC71JTqUaSO1kCi78zXsX6klOoxpIZQQI+IgZI5clh3f3HC8WEe6AIki1KR+962Jcy+Mv591D5CdqmDtIg925XmxcYn7cNJ8CspyvKhtt2Yj1BkjVIaMx4gAHb0OatstVDwcRnVTeNLnty6l//sTWsh47rwx0fjZPQNyMugPl36EcfKs070jzExWZjGSmSGdkH7DfbL30a9Y8glZnOKeBb+G6Hft0gnZmeueBq+/27MYycwQIImnhwKgarOOggUe12ceddBe8gICC/EoQIoOLEtXsS7Lg30FGnLnuSd8V7+Nuo8s5J9SWaijsjD+zULbcXC6MQyTfsWSbw6JxYUWA81dYhyQCJUh8TJkOqhuDuP+e/qlKoq0Qp4ELVxsCaOzn/5SdzRSCunotXHk8TAiYrkAINgcMmQ66Bm0/14hM/Y37s9QcXS9WCeFUYTKkHvtY7ffCzJVPNiTDK86sTs/tFpDfdBCoEeApdUohMqQ8bz7YeNmmxnznldVUFOaBE2wEQoW7kSuvDTwdSB2Fiyfr+JYsVilS3ghwxZwptn9YOpgkYaiheIMU5xIJ+FpZ8R1n0pVRkqX7r7FRQophADA2eYwBlzOQvwZKk4K8n6WNEK6Bx1cbTVc7x9YpaE4i/5w6UcYB7cCJtq6Y+9ZRUtXEvGFvlRCHACnnodd39nKTlNRtYn2y1lSCQFGepPbgdi9CQBUrNBQkk13hpdOCADUtBr49tu9Q7+0xYdUonO8lEKm6k2yUlScL6FZuqQUAgANnyKon+QMvTxPww4/vdKl8H8u0kLaDBEVFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkIMFkKMP3Ud8yPjLurEAAAAAElFTkSuQmCC" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Risk Management - CA Final</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Management - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block52" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Risk Management - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Risk Management - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block53">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAABM0lEQVR4nO3cvwnCQBhA8S/iJA5gpyO4gmBl5QIWjqGd4Ahi5V42ghL/YCysbDTFHXkH7wfpwvHB43IkRapmOmhCGL2uB9A3g8AYBMYgMAaBMQiMQWAMAmMQGIPAGATGIDAGgTEIjEFgDAJjEJh+1wP8tdxGjCZp1qovEfNhmrUycYfAGATGIDAGgeEf6r887xHPR/v762u+WRIpO8h+HXHcdT1FUj6yYAwCYxAYg8AYBMYgMAaBMQhM2S+Gs9Xnamsxjjif8s2TgDsExiAwBoExCEzZh/r9FvG4tb+/eeWbJZGygxw2fn5XXgaBMQiMQWAMAmMQGIPAGATGIDAGgTEIjEFgKv+5yOIOgTEIjEFgDAJjEBiDwBgExiAwBoExCIxBYAwCYxAYg8AYBMYgMAaBeQNIkx5udOR4QQAAAABJRU5ErkJggg==" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Financial Services and Capital...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Services and Capital Markets - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block53" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Financial Services and Capital Markets - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Financial Services and Capital Markets - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block54">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAAA6UlEQVR4nO3cIQpCQRhG0XniHiyGFy3ufxEmqysQRASLUbNgEvHdcE6d8sHlrzNd74/nIGO19ADeCRIjSIwgMYLECBIjSIwgMYLECBIjSIwgMYLECBIjSIwgMYLErJce8K3D8TTOl9vHt3m7Gfvd/N9BP+JCYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkBhBYiZ/Lra4kBhBYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkBhBYgSJESRGkJgXi3UONyx3lQMAAAAASUVORK5CYII=" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">International Taxation - CA Fi...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Taxation - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block54" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">International Taxation - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>International Taxation - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block55">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAABMklEQVR4nO3cywnCQBRA0ReRYBu6FNKGgk1Yi02IYAGCdViD2IQrRcRPdO1GjIzmDtyzDuHBZfIZokV/fniEMDptD6BXBoExCIxBYAwCYxAYg8AYBMYgMAaBMQiMQWAMAmMQGIPAGATGIDDdtgd4ZzHuxWiQbsTh8hjnW7LT/YQrBMYgMAaBMQgM+qb+zuX+iGvd9hTpZRtktb3GbHNpe4zkvGTBGATGIDAGgTEIjEFgsn3snVZlTKvy4+Mn61Ps9vwXF1cIjEFgDAJjEJhsb+pNNxfrTH5JmW0QNxf1FwaBMQiMQWAMAmMQGIPAGAQm2xfDptvvEX7bqy8YBMYgMAaBMQhM4X8usrhCYAwCYxAYg8AYBMYgMAaBMQiMQWAMAmMQGIPAGATGIDAGgTEIjEFgni4PKtbosR/9AAAAAElFTkSuQmCC" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Economic Laws - CA Final</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Laws - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block55" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Economic Laws - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Economic Laws - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block56">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAAD7klEQVR4nO2ayW/bRhyFH4eLVkqiJUV1athFnQ1BDAQuEOSWY//uAumhcA5FAhtoAgeVmliVrF0UtXBRD0EORUDKC0U9OfMBuuhHjh71cTjDIZXuaLqEhAax6QCS/yOFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkKFtOsBNCYIl+sMxegMbw/EEznSG2dyF5/kIlgGEIqBpKnRdQz6bRj6XhlU0UbZM6BrvYSvb9gh3ZDv4+58WPre68Dz/2vsrCmAV89jbreJ+bYdOztYImc0XOH3fwEWrG1ubtUoJL54/jq29OOA6PUJotnv48+zjjXpEFAd792JtLw7ohXxsNHH6vhF7u9lMCrWKFXu7t4V6llX/1FqLDAA4+JGvdwDEPaQ/tPHur/qVti0VcqhVLJStAtIpHYauwQ8CuJ4PezLFyHbQ7gwxGNkAACEU7JMKoRzUg2CJ3/54B3syjdzOzGXw9NE+7pVLV2p3Nl+g/qkNPwjw9OF+HFFjh7KHNC7aK2XUKiUcHz2ApqpXbjedMvD4cO+28dYKpZDzejOyXtkp0E1X44JuUO8NxnCm89C6oWs4fvYgwUTJQiek1elH1g8PdpEy9ITSJA+dkN7ADq2pQlDezMUJnZDR2AmtWaU83dpT3FAJcV0Pnh++PLJTMhNMsxmoTreF60XWM+lUaO3N2w9otnvX+j1D1/Drq1+utc+6oeohvh9E1g2d6vxZC1RCViEUZdMR1g6VECGi/3A35uV3RqiE6CsuSa4XPcbcBaiEpAwdSsRlaWyHT4nvCnSjZC6bDl1YHIwmofsdPztEsPz5m+/HtoPXJ2ex5Vs3VD0EAIpmNrQ2GE1C17mEENBU9ZuPKq6+GswAnZCKVYisNy7aCSXZDHRCalULUbPb83oTE2eWXKCEoROSMvTIJ4BBsMSbtx9W3tVvK3RCAODw4H5kfWQ7+P3kFP3hOKFEyUE3ywKAsmXih6qFfy/Dn43YzgyvT85QLRexW7VgFU0YhgZVFfD9AAvXgzOdo9sfJZj89lAKAYCjJz+hNxivvDRddoe47A4TSrV+KC9ZwJcXEl48fwRV0EZcC9RHaxVNvDx+8l2s8n6FWgjw5aHUq5dHqO4UNx0lEShflAuj3RngvNFEp3fzgVpRFJRLJqrlImpVC2YuE2PC27NVQr4ymy/Q7gzQH9oYT6aYzhZwXQ9+EEBRFKiqgCoEUoaOTNpAJm2gkM+iWMihkM9CEI9LWynkLsN7qnynSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFkSCFk/Af+KymeX0c1MAAAAABJRU5ErkJggg==" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Global Financial Reporting Sta...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Financial Reporting Standards - CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block56" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Global Financial Reporting Standards - CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Global Financial Reporting Standards - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
                              <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block57">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAADh0lEQVR4nO2c3UsUURiHH9evVTMzraDulKIvy/BjlaCCyo+68LLb7qLL6E+J6P8I0jArKWzzK8sU7aICKYoiEb+KdN0uRnF1zrq74x59T7wPiMOZc3Ze95n5zTmziznxG1VxFDGEdrsAZSMqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBgqRBh5u3r0uw+goSV1v3t3oO9h8OOUH4T7fRBKcf79WYCbZ4IfJwu4cYU0XN3e+Eh7ahlCcKPK2ouQmx98fFN79mqxjBtCwiVQcz7Y2LJKOFaX3Xos4oYQCB5bTe7EFbgkpO5ysHGRa9mtwzLuCNl3AI7WZjamrBKO19upxxIyhXwcNbfXpzFFTiTSZo6rT2OZ17RDyBTy5hnElv3tmd5Hmq7722an4X1fsLp2AJlClpdgcsjffrjK+0mHvRXmuBrshoLC7dVnEZlCwsUw3GPel87KHqCx1RxX0U4oCAevzTIyhRSVemeyiXSFNBvian4Gxl9BYVHw2iwjU0i4GH5+hakP/n1VNd7saSv2VsCJRn97/2OIx1VIxoSLvd+DT/z7QqHUV0myuOrv2vj6ApEpZO0MHgoYW6ZnV/MzMBb1tgv0CsmMtTfs8zj8+ubffyoCRXvMY0vLzXE12A0rMW87X2dZmZH4hg0ZZlt5BXDuknlsYyvkGj7med21vp2bu63ybCJTSF7Co/ZMp7/J4ipxMZgj888GqUISb8hjUVic8/c5ewFCm870kjI42eTvO9SzHlfCkSkkkZUYjPT624tL4XTzxrZImzmuoo+slGYD+UIg/diKGOJqYVb0s6vNuCFkpBeW//rb666sb5eU+a8Y2Di7cgA3hPyeh4kBf/v+Q1C9+i2RhpbUsysHcEMImFftsB5bptnVwiyMvrRXkwXcEWJaj4AnxHSDXxvjUFyBS0Kmv5s/6TtSDR23vcXiZvrdiitwSQgkf7bVccvftjgH79yKK3BOyNP0+w73QGzJXi2WcEvI1CT8+JJe32in3Vos4ZYQSP5JYiKOxhW4KCTZqn1zHwfjClwUMjHgPb3dCscWg4m4JyQeh5HnyfcvzsHbFztXT5ZxTwgkX7XD6pfs3IwrgBz9n4uycPMK+Y9RIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcJQIcL4B3oqs7f2ceejAAAAAElFTkSuQmCC" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="advance-badge">
                                                                <span class="badge bg-primary">trending</span>
                            <div class="view-user-img">

                                                                    <a href="" title=""><img src="" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Multidisciplinary Case Study-C...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="rating">
                                                                                            <div class="pull-left">No Rating</div>
                                        <!-- overall rating-->
                                                                                                                        <li class="reviews">
                                            (0 Reviews)
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="count-user">
                                                <i data-feather="user"></i><span>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                             <div class="rate text-right">

                                <div class="img-wishlist">
                                    <div class="protip-wishlist">

                                            <li class="protip-wish-btn"><a href=" Case Study-CA Final" target="__blank" title="reminder"><i data-feather="bell"></i></a></li>
                                                                                            <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>

                    <div id="prime-next-item-description-block57" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <div class="main-des">
                                    <p>Last Updated: 18th December 2021</p>

                                <h5 class="description-heading">Multidisciplinary Case Study-CA Final</h5>

                                <ul class="description-list">
                                        <i data-feather="play-circle"></i>
                                        <div class="class-des"> 
                                            0                                        </div>
                                            <div class="time-des">
                                                <span class="">
                                                    <i data-feather="clock"></i>
                                                                                                     0 Minutes 
                                        <div class="lang-des">
                                                                                                                                                <i data-feather="globe"></i> English

                                <div class="product-main-des">
                                    <p>Multidisciplinary Case Study-CA Final - CA Final</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-8">
                                                                                                                                                 <div class="protip-btn">
                                                        <a href="" class="btn btn-primary" title="Enroll Now">Enroll Now</a>
                                        <div class="col-lg-4">
                                            <div class="img-wishlist">
                                                <div class="protip-wishlist">
                                                                                                                    <li class="protip-wish-btn"><a href="" title="heart"><i data-feather="heart"></i></a></li>
<!-- Students end -->

<!-- Subscription Bundle start -->
<section id="subscription" class="student-main-block">
    <div class="container">
<!-- Subscription Bundle end -->

<!-- Bundle start -->
<section id="bundle-block" class="student-main-block">
    <div class="container">
                <h4 class="student-heading">Bundle Courses</h4>

        <div id="bundle-view-slider" class="student-view-slider-main-block owl-carousel">
                <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-42">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="view-user-img">
                                <a href="" title=""><img src="http://eclass.test/images/user_img/159116548431.jpg" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Economics &amp; Maths - CA Foundat...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <!-- <p class="btm-10"><a herf="#">by  Team Online Ca Classes </a></p> -->

                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <p class="view-date"><a herf="#"><i data-feather="calendar"></i> 11-12-2021</a></p>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                            <div class="rate text-right">


                    <div id="prime-next-item-description-block-42" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <h5 class="description-heading">Economics &amp; Maths - CA Foundation</h5>

                               <div class="product-main-des">
                                    <p>Economics &amp;amp; Maths for CA Foundation by CA Vaibhav Jalan</p>
                                    <div class="product-learn-dtl">

                                            <li><i data-feather="check-circle"></i> 
                                                <a href="#"></a>
                                            <li><i data-feather="check-circle"></i> 
                                                <a href="#"></a>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-12">
                                                                                                                                                <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>

                <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-43">
                        <div class="view-block">
                            <div class="view-img">
                                                                    <a href=""><img data-src="" alt="course" class="img-fluid owl-lazy"></a>
                            <div class="view-user-img">
                                <a href="" title=""><img src="http://eclass.test/images/user_img/159116548431.jpg" class="img-fluid user-img-one" alt=""></a>
                            <div class="view-dtl">
                                <div class="view-heading"><a href="">Economics, Law &amp; English CA Fo...</a></div>
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <!-- <p class="btm-10"><a herf="#">by  Team Online Ca Classes </a></p> -->

                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <p class="view-date"><a herf="#"><i data-feather="calendar"></i> 11-12-2021</a></p>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6"> 
                                                                                            <div class="rate text-right">


                    <div id="prime-next-item-description-block-43" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <h5 class="description-heading">Economics, Law &amp; English CA Foundation</h5>

                               <div class="product-main-des">
                                    <p>Economics, Law &amp;amp; English CA Foundation by CA Vaibhav Jalan</p>
                                    <div class="product-learn-dtl">

                                            <li><i data-feather="check-circle"></i> 
                                                <a href="#"></a>
                                            <li><i data-feather="check-circle"></i> 
                                                <a href="#"></a>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-12">
                                                                                                                                                <div class="protip-btn">
                                                        <a href="" class="btn btn-primary"><i class="fa fa-cart-plus" aria-hidden="true"></i>&nbsp;Add To Cart</a>

<!-- Bundle end -->

<!-- Advertisement -->

<!-- Batch start -->

<section id="batch-block" class="student-main-block">
    <div class="container">

<!-- Batch end -->

<!-- Zoom start -->
<section id="student" class="student-main-block" style="display:none;">
    <div class="container">
                        <h4 class="student-heading">Live Meetings</h4>
        <div id="zoom-view-slider" class="student-view-slider-main-block owl-carousel">

                    <div class="item student-view-block student-view-block-1">
                        <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-74">
                            <div class="view-block">
                                <div class="view-img">
                                    <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAADvElEQVR4nO2a23PaRhSHf0ICIYEwYALxLYnr6Ys9mcSTvOWfz0tmkmkf3Mu4des41BfsYnNHIJCQ+tD0knQkxmGBn+h+r0faOfDN7tHuWaXRHQaQ0JBYdgKST5FCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyNCWncAstDo91O866PYH6NlDuK4H15sgoSjQNBV6KgkrayCXNVEqriGfyyw75akocWvhup6H6kUdHy5uMBq793pXTyWxUS7iyXYZVtacU4azESshl9d3+PGkCtebzDzW9kYJhwd7ArISSyyWLN8PcHT8Hlc3DWFjZk1D2FgioRfi+z7eHZ3grtkVNqaiADubJWHjiYT+K+v7n6tCZQBApVRAWk8JHVMU1DPk8voOF7Xbqc9VSnlsVtaRs0zoqSSCIIAzctHq9HHbaKPe6CAI/imVj7fK80x7JmiFeN4Ex7+eRz5jGjoOD/ZQzFv/iaX1FPK5DHZ3KhiNXZxf1fHbVR0AUC7l55KzCGi/sk6rNfx0ehEaNw0dr17u33vpsQcOMmZ61vTmBm0NqV7+Hhl/8fTrL6oDzDIAUiGNVg9DZxwaf7RVjsWu+0ugFHLbbEfGd7crC8pk8VAKabR6obFsxkDO4jz2EAGlkL49DI0VVnSp+gs6Ia7nYex6ofGcJYUsFNeNPjhMJWm3TkKgE+JNooUkk+qCMlkOdEKUqfFpT8QbOiGaFj0Dps2guEMnJKlF1wgRzSlm6IRomgolYlWK+iReBeiEAEAmopvX7Q0WmMnioRRSXMuGxpqdHlwvfJ8SdyiFFCKE+H6AmsDeOhuUQkrFtcj4ydkVvBUt7pRCTENHJaKrNxq7ODo++6QtuypQCgGAJzvRR+zX9Sa++e4XOKPwvsnndPsDnJxd4rRamzW9uUHbwgWAN98eo9kOP4oHADWRwNbDdZRLeVgZA6mPlxw8bwJ76KBvD9Hq2Gi0un/fdHy0+QDP9r9axE+4N9RChs4Ir9/+ILxeMAuhXbIAwEjreE76x80LaiEAsFEu4vBgD0rU9n2FoBcC/Hkx+tXLfWTJb4yIgLqGfI7vBziv1XF2fgN74Nz7fU1V8bBcwO5OBflc+OZzmcRKyL9pd23cNjpod/uwBw6c0RjexAcQQE2oUNUEjHQKGTMNK2NivWAhn8sikeBe+mIrZFWJRQ35PyGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkPEH0yErz9bPKn8AAAAASUVORK5CYII=" alt="course" class="img-fluid owl-lazy"></a>

                                                                <div class="meeting-icon"><img src="" class="img-circle" alt=""></div>
                                <div class="view-dtl">
                                    <div class="view-heading"><a href="">course intro</a></div>
                                    <div class="user-name">
                                        <h6>By <span>Team</span></h6>
                                    <div class="view-footer">
                                        <div class="row">
                                            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                                <div class="view-date">
                                                    <a href="#"><i data-feather="calendar"></i> 24-12-2021</a>
                                            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                                <div class="view-time">
                                                    <a href="#"><i data-feather="clock"></i> 12:08:00 PM</a>
                        <div id="prime-next-item-description-block-74" class="prime-description-block">
                            <div class="prime-description-under-block">
                                <div class="prime-description-under-block">
                                    <h5 class="description-heading">course intro</h5>
                                    <div class="protip-img">
                                        <a href=""><img src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAADvElEQVR4nO2a23PaRhSHf0ICIYEwYALxLYnr6Ys9mcSTvOWfz0tmkmkf3Mu4des41BfsYnNHIJCQ+tD0knQkxmGBn+h+r0faOfDN7tHuWaXRHQaQ0JBYdgKST5FCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyJBCyNCWncAstDo91O866PYH6NlDuK4H15sgoSjQNBV6KgkrayCXNVEqriGfyyw75akocWvhup6H6kUdHy5uMBq793pXTyWxUS7iyXYZVtacU4azESshl9d3+PGkCtebzDzW9kYJhwd7ArISSyyWLN8PcHT8Hlc3DWFjZk1D2FgioRfi+z7eHZ3grtkVNqaiADubJWHjiYT+K+v7n6tCZQBApVRAWk8JHVMU1DPk8voOF7Xbqc9VSnlsVtaRs0zoqSSCIIAzctHq9HHbaKPe6CAI/imVj7fK80x7JmiFeN4Ex7+eRz5jGjoOD/ZQzFv/iaX1FPK5DHZ3KhiNXZxf1fHbVR0AUC7l55KzCGi/sk6rNfx0ehEaNw0dr17u33vpsQcOMmZ61vTmBm0NqV7+Hhl/8fTrL6oDzDIAUiGNVg9DZxwaf7RVjsWu+0ugFHLbbEfGd7crC8pk8VAKabR6obFsxkDO4jz2EAGlkL49DI0VVnSp+gs6Ia7nYex6ofGcJYUsFNeNPjhMJWm3TkKgE+JNooUkk+qCMlkOdEKUqfFpT8QbOiGaFj0Dps2guEMnJKlF1wgRzSlm6IRomgolYlWK+iReBeiEAEAmopvX7Q0WmMnioRRSXMuGxpqdHlwvfJ8SdyiFFCKE+H6AmsDeOhuUQkrFtcj4ydkVvBUt7pRCTENHJaKrNxq7ODo++6QtuypQCgGAJzvRR+zX9Sa++e4XOKPwvsnndPsDnJxd4rRamzW9uUHbwgWAN98eo9kOP4oHADWRwNbDdZRLeVgZA6mPlxw8bwJ76KBvD9Hq2Gi0un/fdHy0+QDP9r9axE+4N9RChs4Ir9/+ILxeMAuhXbIAwEjreE76x80LaiEAsFEu4vBgD0rU9n2FoBcC/Hkx+tXLfWTJb4yIgLqGfI7vBziv1XF2fgN74Nz7fU1V8bBcwO5OBflc+OZzmcRKyL9pd23cNjpod/uwBw6c0RjexAcQQE2oUNUEjHQKGTMNK2NivWAhn8sikeBe+mIrZFWJRQ35PyGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkCGFkPEH0yErz9bPKn8AAAAASUVORK5CYII=" alt="course" class="img-fluid"></a>

                                    <div class="main-des">
                                    <div class="des-btn-block">
                                        <div class="row">
                                            <div class="col-lg-12">
                                                <div class="item student-view-block student-view-block-1">
                        <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-660tsf05lce8breqln4kj41mt2k">
                            <div class="view-block">
                                <div class="view-img">

                                                                           <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAABKklEQVR4nO3aIQ7CMBhA4b/bBCEcAEEQIJB4HIfGcgAwWA6xkIDAsIGGAAOx7CV7n+22NnltMtFUnq/3EEbW9QL0zCAwBoExCIxBYAwCYxAYg8AYBMYgMAaBMQiMQWAMAmMQGIPAGASm6HoBr+q6js123/o8o+Eg1qtl6/P8yxMCYxAYg8AYBMYgMIl4L+tWVY3P7A7HKE+Xt2Oz6TgW88nX91OkyHPefsT99kZEFHne+ExK6eNYlqWfvkHE2yI9ZxAYg8AYBMYgMAaBMQiMQWAMAmMQGIPAGATGIDAGgTEIjEFgDAJjEBiDwBgExiAwBoExCIxBYAwCYxAY5N3ePvOEwBgExiAwBoExCIxBYAwCYxAYg8AYBMYgMAaBMQiMQWAMAmMQGIPAPACr0Rsp850BJAAAAABJRU5ErkJggg==" alt="course" class="img-fluid owl-lazy"></a>

                                                                <div class="meeting-icon"><img src="" class="img-circle" alt=""></div>
                                <div class="view-dtl">
                                    <div class="view-heading"><a href="#"> Testing Google meet</a></div>
                                    <div class="user-name">
                                        <h6>By <span>Team</span></h6>
                                    <div class="view-footer">
                                        <div class="row">
                                            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                                <div class="view-date">
                                                    <a href="#"><i data-feather="calendar"></i> 07-12-2021</a>
                                            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                                <div class="view-time">
                                                    <a href="#"><i data-feather="clock"></i> 03:57:00 PM</a>
                        <div id="prime-next-item-description-block-660tsf05lce8breqln4kj41mt2k" class="prime-description-block">
                            <div class="prime-description-under-block">
                                <div class="prime-description-under-block">
                                    <h5 class="description-heading"><a href="">Testing Google meet</a></h5>
                                    <div class="protip-img">
                                        <h3 class="description-heading">by  UPma </h>
                                        <p class="meeting-owner btm-10"><a herf="#">Meeting Owner: </a></p>
                                    <div class="main-des">
                                        <p class="btm-10"><a herf="#">Start At: 07-12-2021 | 03:57:00 PM</a></p>
                                    <div class="main-des">
                                        <p class="btm-10"><a herf="#">End At: 07-12-2021 | 04:57:00 PM</a></p>
                                    <div class="des-btn-block">
                                        <a href="" target="_blank" class="btn btn-light">Join Meeting</a>
                                                <div class="item student-view-block student-view-block-1">
                        <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-69734676267">
                            <div class="view-block">
                                <div class="view-img">

                                                                           <a href=""><img data-src="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAGQAAABGCAYAAAA6hjFpAAAACXBIWXMAAA7EAAAOxAGVKw4bAAABLElEQVR4nO3aOwrCQBgA4T/GnETQu9jbW6bwEDa2YuNFxC5g4WmCV8jLWvENIQPO1+4muzBsSLHJfJF3IYzR0BvQLYPAGATGIDAGgTEIjEFgDAJjEBiDwBgExiAwBoExCIxBYAwCYxCY8dAbuJemaex3m97XKctLrDfb3tf5licExiAwBoExCIxBYBLivawsy97OWeXLmE0nD8eK0zkOx+Ll813XRV3XP+2vT7jf3oiIqqrezmnb9ulYUzcfvYPITxaMQWAMAmMQGIPAGATGIDAGgTEIjEFgDAJjEBiDwBgExiAwBoExCIxBYAwCYxAYg8AYBMYgMAaBMQiMQWCQd3v/mScExiAwBoExCIxBYAwCYxAYg8AYBMYgMAaBMQiMQWAMAmMQGIPAGATmCixMJHKc8GsHAAAAAElFTkSuQmCC" alt="course" class="img-fluid owl-lazy"></a>

                                                                <div class="meeting-icon"><img src="" class="img-circle" alt=""></div>
                                <div class="view-dtl">
                                    <div class="view-heading"><a href="#"> Testing JITSI</a></div>
                                    <div class="user-name">
                                        <h6>By <span>Team</span></h6>
                                    <div class="view-footer">
                                        <div class="row">
                                            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                                <div class="view-date">
                                                    <a href="#"><i data-feather="calendar"></i> 01-01-1970</a>
                                            <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                                <div class="view-time">
                                                    <a href="#"><i data-feather="clock"></i> 12:00:00 AM</a>
                        <div id="prime-next-item-description-block-69734676267" class="prime-description-block">
                            <div class="prime-description-under-block">
                                <div class="prime-description-under-block">
                                    <h5 class="description-heading"><a href="">Testing JITSI</a></h5>
                                    <div class="protip-img">
                                        <h3 class="description-heading">by  UPma </h>
                                        <p class="meeting-owner btm-10"><a herf="#">Meeting Owner: </a></p>
                                    <div class="main-des">
                                        <p class="btm-10"><a herf="#">Start At: 01-01-1970 | 12:00:00 AM</a></p>
                                    <div class="main-des">
                                        <p class="btm-10"><a herf="#">End At: 30-11--0001 | 12:00:00 AM</a></p>
                                    <div class="des-btn-block">
                                        <a href="" target="_blank" class="btn btn-light">Join Meeting</a>


<!-- Zoom end -->

<!-- google class room start -->

<!-- google class room end -->

<!-- Bundle start -->
<section id="student" class="student-main-block">
    <div class="container">
        <h4 class="student-heading">Recent Blogs</h4>
        <div id="blog-post-slider" class="student-view-slider-main-block owl-carousel">
                <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-811">
                        <div class="view-block">
                            <div class="view-img">
                                                                                                            <a href="">
                                        <img data-src=" (8) (25).jpeg" alt="course" class="img-fluid owl-lazy">
                            <div class="view-dtl">
                                <div class="view-heading">
                                                                             <a href="">
                                            CA Foundation Study Plan
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-date">
                                                <a href="#"><i data-feather="calendar"></i> 01-01-1970</a>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-time">
                                                <a href="#"><i data-feather="clock"></i> 12:00:00 AM</a>
                    <div id="prime-next-item-description-block-811" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <h5 class="description-heading">CA Foundation Study Plan</h5>
                                <div class="protip-img">
                                                                                                                        <a href="">
                                                                                    <img src=" (8) (25).jpeg" alt="course" class="img-fluid">

                                <div class="main-des">
                                    <p>CA Foundation Study Plan</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-12">
                <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-810">
                        <div class="view-block">
                            <div class="view-img">
                                                                                                            <a href="">
                                        <img data-src=" (8) (25).jpeg" alt="course" class="img-fluid owl-lazy">
                            <div class="view-dtl">
                                <div class="view-heading">
                                                                             <a href="">
                                            CA Exam Preparation
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-date">
                                                <a href="#"><i data-feather="calendar"></i> 01-01-1970</a>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-time">
                                                <a href="#"><i data-feather="clock"></i> 12:00:00 AM</a>
                    <div id="prime-next-item-description-block-810" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <h5 class="description-heading">CA Exam Preparation</h5>
                                <div class="protip-img">
                                                                                                                        <a href="">
                                                                                    <img src=" (8) (25).jpeg" alt="course" class="img-fluid">

                                <div class="main-des">
                                    <p>How to Prepare for CA?</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-12">
                <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-89">
                        <div class="view-block">
                            <div class="view-img">
                                                                                                            <a href="">
                                        <img data-src=" (8) (25).jpeg" alt="course" class="img-fluid owl-lazy">
                            <div class="view-dtl">
                                <div class="view-heading">
                                                                             <a href="">
                                            Is Ca Tough?
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-date">
                                                <a href="#"><i data-feather="calendar"></i> 01-01-1970</a>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-time">
                                                <a href="#"><i data-feather="clock"></i> 12:00:00 AM</a>
                    <div id="prime-next-item-description-block-89" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <h5 class="description-heading">Is Ca Tough?</h5>
                                <div class="protip-img">
                                                                                                                        <a href="">
                                                                                    <img src=" (8) (25).jpeg" alt="course" class="img-fluid">

                                <div class="main-des">
                                    <p>Is Ca Tough?</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-12">
                <div class="item student-view-block student-view-block-1">
                    <div class="genre-slide-image  protip " data-pt-placement="outside" data-pt-interactive="false" data-pt-title="#prime-next-item-description-block-87">
                        <div class="view-block">
                            <div class="view-img">
                                                                                                            <a href="">
                                        <img data-src=" (8) (25).jpeg" alt="course" class="img-fluid owl-lazy">
                            <div class="view-dtl">
                                <div class="view-heading">
                                                                             <a href="">
                                            10 Tips to Clear CA found...
                                <div class="user-name">
                                    <h6>By <span>Team</span></h6>
                                <div class="view-footer">
                                    <div class="row">
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-date">
                                                <a href="#"><i data-feather="calendar"></i> 01-01-1970</a>
                                        <div class="col-lg-6 col-md-6 col-sm-6 col-6">
                                            <div class="view-time">
                                                <a href="#"><i data-feather="clock"></i> 12:00:00 AM</a>
                    <div id="prime-next-item-description-block-87" class="prime-description-block">
                        <div class="prime-description-under-block">
                            <div class="prime-description-under-block">
                                <h5 class="description-heading">10 Tips to Clear CA foundation in first attempt</h5>
                                <div class="protip-img">
                                                                                                                        <a href="">
                                                                                    <img src=" (8) (25).jpeg" alt="course" class="img-fluid">

                                <div class="main-des">
                                    <p>10 tips for ca foundation clearance in one go</p>
                                <div class="des-btn-block">
                                    <div class="row">
                                        <div class="col-lg-12">
<!-- Bundle end -->
<!-- recommendations start -->
<section id="border-recommendation" class="border-recommendation">
    <div class="top-border"></div>
    <div class="recommendation-main-block  text-center" style="background-image: url('')">
        <div class="container">
            <h3 class="text-white">Best Online CA Classes</h3>
            <p class="text-white btm-20">With Best Teachers &amp; Support</p>
                        <div class="recommendation-btn text-white">
                <a href=";category=CA%20Foundation" class="btn btn-primary" title="search">Explore our Courses</a>
<!-- recommendations end -->
<!-- categories start -->

<section id="categories" class="categories-main-block">
    <div class="container">
        <h3 class="categories-heading btm-30">Featured Categories</h3>
        <div class="row">

            <div class="col-lg-2 col-md-2 col-sm-6 col-6">

                <div class="image-container btm-20">
                <a href=";category=bestcoachingcafinalonlineclassespendrive">

                  <div class="image-overlay">
                    <i class="fa fa-window-maximize"></i>CA-Final

                                      <img src="">

            <div class="col-lg-2 col-md-2 col-sm-6 col-6">

                <div class="image-container btm-20">
                <a href=";category=stockmarketcourses">

                  <div class="image-overlay">
                    <i class="fa fa-tv"></i>Stock Market

                                      <img src="">

            <div class="col-lg-2 col-md-2 col-sm-6 col-6">

                <div class="image-container btm-20">
                <a href=";category=camockexamtestseries">

                  <div class="image-overlay">
                    <i class="fa fa-window-maximize"></i>Mock Test Series

                                      <img src="">

            <div class="col-lg-2 col-md-2 col-sm-6 col-6">

                <div class="image-container btm-20">
                <a href=";category=bestcoachingcafoundationonlineclassespendrive">

                  <div class="image-overlay">
                    <i class="fa fa-window-maximize"></i>CA Foundation

                                      <img src="">

            <div class="col-lg-2 col-md-2 col-sm-6 col-6">

                <div class="image-container btm-20">
                <a href=";category=bestcoachingcainteronlineclassespendrive">

                  <div class="image-overlay">
                    <i class="fa fa-window-maximize"></i>CA-Inter

                                      <img src="">


<!-- categories end -->
<!-- testimonial start -->

<section id="testimonial" class="testimonial-main-block">
    <div class="container">
        <h3 class="btm-30">What our students have to say</h3>
        <div id="testimonial-slider" class="testimonial-slider-main-block owl-carousel">
                        <div class="item testimonial-block">
                    <li><img data-src=" (8) (24).jpeg" alt="blog" class="img-fluid owl-lazy"></li>
                    <li><h5 class="testimonial-heading">Rihaan Singh</h5>
                                                 <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                        <h6>CA Foundation Student - 2021 Dec</h6>
                <p>My friend referred me to Online CA &amp; in my experience this is one of the best platform for taking Online CA Classes.Course Support, Notes, Test Series &amp; Extra Services given by the team is perfect. I have tried test series of them along with the course and found it very useful for the ex...</p>
                        <div class="item testimonial-block">
                    <li><img data-src=" (5).png" alt="blog" class="img-fluid owl-lazy"></li>
                    <li><h5 class="testimonial-heading">Yashasvi Bansal</h5>
                                                 <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                        <h6>CA Foundation Student - 2021 Dec</h6>
                <p>This Website has a lot of great teachers, who know how to make us(students) understand the concepts very clearly. It was a really grest journey for my CA Foundation attempt. Great Start for my CA Career. The mock-tests held by them also challenges us to push ourselves to the peak of our performance....</p>
                        <div class="item testimonial-block">
                    <li><img data-src="" alt="blog" class="img-fluid owl-lazy"></li>
                    <li><h5 class="testimonial-heading">Kamya Garg</h5>
                                                 <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                        <h6>CA Foundation &amp; Costing Student</h6>
                <p>Took Foundation classes and recently costing also and i can assure the best platform to purchase the course. Website is smooth and elegant &amp; After sales support is a Great experience unlike other teachers original website. Online CA Classes has helped me to find notes and tests as well. Great going </p>
                        <div class="item testimonial-block">
                    <li><img data-src=" i_alphabet_logo.png" alt="blog" class="img-fluid owl-lazy"></li>
                    <li><h5 class="testimonial-heading">Ikrant Raheja</h5>
                                                 <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                         <i class='fa fa-star' style='color:orange'></i>
                                                                        <h6>CA Foundation Student - 2022 May</h6>
                <p>Best coaching institute for Online CA Classes. Free Resume Builder &amp; Excel Course given by the platform is very nice. I would suggest everyone to try the services atleast once to know the benefits as compare to original teachers. Customer support team is very supportive. Thanks a ton for smooth expe...</p>
<!-- testimonial end -->

<!-- Advertisement -->

<section id="trusted" class="trusted-main-block">
    <!-- google adsense code -->
    <div class="container-fluid" id="adsense">

<!-- testimonial end -->
<!-- footer start -->
<footer id="footer" class="footer-main-block">
    <div class="container">
        <div class="footer-block">
            <div class="row">
                                <div class="col-lg-4 col-md-6 col-12">
                    <div class="footer-logo">
                                                                                <a href="" title="logo"><img src="" alt="logo" class="img-fluid" ></a>


                    <div class="mobile-btn">
                                                    <a href="" title=""><img src="" alt="logo"></a>
                                                                            <a href="" title=""><img src="" alt="logo"></a>

                <div class="col-lg-2 col-md-6 col-4">
                    <div class="widget"><b>About us</b></div>
                    <div class="footer-link">
                                                                                                <li><a href="" title="Become an instructor">Become An Instructor</a></li>
                                                        <li><a href="" title="About Us">About us</a></li>
                                                        <li><a href="" title="Contact Us">Contact us</a></li>
                <div class="col-lg-2 col-md-6 col-4">
                    <div class="widget"><b>Help</b></div>
                    <div class="footer-link">
                                                        <li><a href="" title="Careers">Careers</a></li>
                                                        <li><a href="" title="Blog">Blog</a></li>
                                                        <li><a href="" title="Help">Help &amp; Support</a></li>
                <div class="col-lg-2 col-md-6 col-4">
                    <div class="widget"><b>Other links</b></div>
                    <div class="footer-link">
                           <li><a href="" title="List pages">List Pages</a></li>
 <li><a href="" title="List Instructors">List Instructors</a></li>

 <li><a href="" title="List institutes">List Institutes</a></li>


                <div class="col-lg-2 col-md-6">

                                                            <div class="footer-dropdown">
                        <a href="#" class="a" data-toggle="dropdown"><i data-feather="globe"></i>En<i class="fa fa-angle-up lft-10"></i></a>
                        <ul class="dropdown-menu">
                                                        <a href=""><li>English</li></a>

                                                            <div class="footer-dropdown footer-dropdown-two">
                        <a href="#" class="a" data-toggle="dropdown"><i data-feather="credit-card"></i> INR<i class="fa fa-angle-up lft-10"></i></a>
                        <ul class="dropdown-menu">
                                                        <a href=""><li>INR</li></a>
    <div class="tiny-footer">
        <div class="container">
            <div class="row">
                <div class="col-md-6">
                    <div class="logo-footer">

                            <li>Copyright © 2022 ONLINE CA CLASSES</li>
                <div class="col-md-6">
                    <div class="copyright-social">
                            <li><a href="" title="Terms">Terms &amp; Condition</a></li> 
                            <li><a href="" title="Policy">Privacy Policy</a></li>

<div class="modal fade" data-backdrop="" style="z-index: 99999999999999999;" id="myModalinstructor" tabindex="-1" role="dialog" aria-labelledby="myModalLabel">
    <div class="modal-dialog modal-lg" role="document">
      <div class="modal-content">
        <div class="modal-header">

          <h4 class="modal-title" id="myModalLabel">Become An Instructor</h4>
          <button type="button" class="close" data-dismiss="modal" aria-label="Close"><span aria-hidden="true">&times;</span></button>
        <div class="box box-primary">
          <div class="panel panel-sum">
            <div class="modal-body">
                              <div class="box-footer">
                  <button type="submit" onclick="window.location.href = '';" class="btn btn-lg col-md-3 btn-primary">Submit</button>

<!-- footer end -->
<!-- jquery -->
<script src=""></script> <!-- jquery library js -->
<script src=""></script> <!-- colorbox js -->
<script src=""></script> <!-- bootstrap js -->
<script src=""></script> <!-- facts count js required for jquery.counterup.js file -->
<script src=""></script> <!-- facts count js-->
<script src=""></script> <!-- owl carousel js -->	
<script src=""></script> <!-- smooth scroll js -->
<script src=""></script> <!-- popup js-->
<script src=""></script> <!-- navigation js--> 
<script src=""></script> <!-- mail chimp js --> 
<script src=""></script> <!-- protip js -->
<script src=""></script> <!-- custom js -->
<script src=""></script> <!-- player js --> 
<script src=""></script> <!-- filter js --> 
<script src=""></script><!-- iconpicker js -->
<script src=""></script>
<script src=""></script> <!-- protip js -->
<script src=""></script> <!-- select2 -->
<script src=""></script>
<script src=""></script>
<script src=""></script>
<script src=""></script>
<script src=""></script>
<script>var sendurl = "https:\/\/\/autocomplete\/fetch";</script>
<script src=""></script>

<script src=""></script>

<script src=''></script>
<script src=""></script>

<script src=""></script>

<script src=""></script>



    "use strict";


        effect: "fadeIn",
        effectTime: 1000,
        scrollDirection: 'both',
        threshold: 0



<script async src=""></script>
  window.dataLayer = window.dataLayer || [];
  function gtag(){dataLayer.push(arguments);}
  gtag('js', new Date());

  gtag('config', 'UA-214737659-1');


        var url = $(this).data('url');

        location.href = url;



        var url = $(this).data('url');

        location.href = url;



        var url = $(this).data('url');

        location.href = url;


<script type="text/javascript">

        phone: '+91 9999940593',
        popupMessage: 'Connect with us on WhatsApp',
        message: "",
        showPopup: true,
        position: "left",
        linkButton: false,
        showOnIE: false,
        headerTitle: 'Whatsapp connect',
        headerColor: '#000000',
        backgroundColor: '#25d366',
        zIndex: 999999999999,
        buttonImage: '<img src="" />',


<script  src=""></script>

  var ONESIGNAL_APP_ID = "3d42ccb3-80e5-462b-85f3-ff577c6f20f0";
  var USER_ID = '';
<script  src=""></script>

    (function($) {
      "use strict";
        $(function() {
           $( "#home-tab" ).trigger( "click" );

    function showtab(id){
            type : 'GET',
            url  : ''+id,
            dataType  : 'json',
            success : function(data){



<script src=""></script>

    "use Strict";
  headers: {
    'X-CSRF-TOKEN': $('meta[name="csrf-token"]').attr('content')
$(function () {
    $('.compare').on('click', function (e) {
        var id = $(this).data('id');
        type: "POST",
        dataType: "json",
        data: {
            id: id
            success: function (data) {

<!-- end jquery -->
<!-- body end -->